Loading...
Statistics
Advertisement

putabirdonit
www.lolawong.com/

Lolawong.com

Advertisement
Conversion Technology Metas Server
Lolawong.com is hosted in United States / Brea . Lolawong.com uses HTTPS protocol. Number of used technologies: 3. First technologies: Html, Html5, Javascript, Number of used javascripts: 1. First javascripts: Putabirdonit_hy..._script.js, Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Lolawong.com

Technology

Number of occurences: 3
  • Html
  • Html5
  • Javascript

Advertisement

Javascripts

Number of occurences: 1
  • putabirdonit_hype_generated_script.js

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Lolawong.com

SSL certificate

    • name: /C=US/ST=California/O=DreamHost/CN=sni.dreamhost.com
    • subject:
      • C: US
      • ST: California
      • O: DreamHost
      • CN: sni.dreamhost.com
    • hash: cce3888a
    • issuer:
      • C: US
      • ST: California
      • O: DreamHost
      • CN: sni.dreamhost.com
    • version: 2
    • serialNumber: 50159747054
    • validFrom: 150811182423Z
    • validTo: 250808182423Z
    • validFrom_time_t: 1439317463
    • validTo_time_t: 1754677463
    • extensions:
      • basicConstraints: CA:FALSE

Meta - Lolawong.com

Number of occurences: 2
  • Name:
    Content: chrome=1
  • Name: viewport
    Content: user-scalable=yes, width=600px

Server / Hosting

  • IP: 69.163.153.119
  • Latitude: 33.93
  • Longitude: -117.86
  • Country: United States
  • City: Brea

Rname

  • ns2.dreamhost.com
  • ns1.dreamhost.com
  • ns3.dreamhost.com
  • fltr-in2.mail.dreamhost.com
  • fltr-in1.mail.dreamhost.com

Target

  • hostmaster.dreamhost.com

HTTP Header Response

HTTP/1.1 200 OK Date: Sat, 10 Sep 2016 17:53:24 GMT Server: Apache Last-Modified: Mon, 06 Jun 2011 18:57:10 GMT ETag: "4261c73a-2dd-4a50fabaa4d80" Accept-Ranges: bytes Content-Length: 733 Vary: Accept-Encoding MS-Author-Via: DAV Content-Type: text/html X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

DNS

host: lolawong.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 69.163.153.119
host: lolawong.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns2.dreamhost.com
host: lolawong.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns1.dreamhost.com
host: lolawong.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns3.dreamhost.com
host: lolawong.com
  1. class: IN
  2. ttl: 14400
  3. type: SOA
  4. mname: ns1.dreamhost.com
  5. rname: hostmaster.dreamhost.com
  6. serial: 2016052300
  7. refresh: 16613
  8. retry: 1800
  9. expire: 1814400
  10. minimum-ttl: 14400
host: lolawong.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: fltr-in2.mail.dreamhost.com
host: lolawong.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: fltr-in1.mail.dreamhost.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.olawong.com, www.luolawong.com, www.uolawong.com, www.l8olawong.com, www.8olawong.com, www.l9olawong.com, www.9olawong.com, www.ljolawong.com, www.jolawong.com, www.l0olawong.com, www.0olawong.com, www.lmolawong.com, www.molawong.com, www.lpolawong.com, www.polawong.com, www.loolawong.com, www.oolawong.com, www.llawong.com, www.loblawong.com, www.lblawong.com, www.lohlawong.com, www.lhlawong.com, www.loglawong.com, www.lglawong.com, www.lojlawong.com, www.ljlawong.com, www.lomlawong.com, www.lmlawong.com, www.lo lawong.com, www.l lawong.com, www.lovlawong.com, www.lvlawong.com, www.loawong.com, www.loluawong.com, www.louawong.com, www.lol8awong.com, www.lo8awong.com, www.lol9awong.com, www.lo9awong.com, www.loljawong.com, www.lojawong.com, www.lol0awong.com, www.lo0awong.com, www.lolmawong.com, www.lomawong.com, www.lolpawong.com, www.lopawong.com, www.loloawong.com, www.looawong.com, www.lolwong.com, www.lolaowong.com, www.lolowong.com, www.lolapwong.com, www.lolpwong.com, www.lola9wong.com, www.lol9wong.com, www.lolawong.com, www.lolwong.com, www.lolaiwong.com, www.loliwong.com, www.lolauwong.com, www.loluwong.com, www.lolaong.com, www.lolaw ong.com, www.lola ong.com, www.lolawcong.com, www.lolacong.com, www.lolawong.com, www.lolaong.com, www.lolawdong.com, www.loladong.com, www.lolawfong.com, www.lolafong.com, www.lolawgong.com, www.lolagong.com, www.lolawbong.com, www.lolabong.com, www.lolawng.com, www.lolawobng.com, www.lolawbng.com, www.lolawohng.com, www.lolawhng.com, www.lolawogng.com, www.lolawgng.com, www.lolawojng.com, www.lolawjng.com, www.lolawomng.com, www.lolawmng.com, www.lolawo ng.com, www.lolaw ng.com, www.lolawovng.com, www.lolawvng.com, www.lolawog.com, www.lolawonng.com, www.lolawong.com, www.lolawonhg.com, www.lolawohg.com, www.lolawonjg.com, www.lolawojg.com, www.lolawonkg.com, www.lolawokg.com, www.lolawonlg.com, www.lolawolg.com, www.lolawon g.com, www.lolawo g.com, www.lolawon.com, www.lolawongs.com, www.lolawons.com, www.lolawongx.com, www.lolawonx.com, www.lolawongy.com, www.lolawony.com, www.lolawongh.com, www.lolawonh.com, www.lolawongn.com, www.lolawonn.com, www.lolawongc.com, www.lolawonc.com, www.lolawongd.com, www.lolawond.com, www.lolawonge.com, www.lolawone.com, www.lolawongr.com, www.lolawonr.com, www.lolawongt.com, www.lolawont.com, www.lolawongb.com, www.lolawonb.com, www.lolawongv.com, www.lolawonv.com,

Other websites we recently analyzed

  1. pleasegivewillyapleasemaamsir.biz
    Scottsdale (United States) - 50.63.202.45
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  2. TXMayday Enterprises - Airplane enginees, parts
    The web-based aircraft parts locater system, marketplace and business network for the aviation industry. We bring buyers and sellers together - global, fast and effective
    Scottsdale (United States) - 50.63.196.46
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 5
    Number of meta tags: 5
  3. spherepr.net
    Australia - 202.124.241.178
    Server software: Redirector - NetRegistry Pty Ltd
    Technology: Html
    Number of meta tags: 2
  4. kmlsny.com
    San Jose (United States) - 69.46.84.52
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  5. hollyenerqy.com
    New York (United States) - 69.172.201.217
    Server software: DOSarrest
    Technology: Html, Javascript
    Number of meta tags: 1
  6. inculata.org
    Dallas (United States) - 75.126.102.254
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  7. Винтовые сваи - Установка и продажа винтовых свай дешево!
    Винтовые сваи в Челябинске и области по низким ценам! Бесплатный расчет фундамента - быстро, качественно, гарантии!
    Germany - 37.1.219.22
    Server software: nginx/1.0.15
    Technology: CSS, Html, Javascript, jQuery, Php, Yandex.Metrika
    Number of Javascript: 7
    Number of meta tags: 2
  8. Test 33 | Home
    Test 33 | Home
    Italy - 109.168.121.67
    G Analytics ID: UA-36932869-3
    Server software: Apache
    Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery Validate, Google Analytics
    Number of Javascript: 13
    Number of meta tags: 4
  9. air93.com
    Kirkland (United States) - 98.124.245.24
    Server software: Apache/2.2.15 (CentOS)
    Technology: Html, Javascript
    Number of Javascript: 1
    Number of meta tags: 1
  10. usin.space
    Austin (United States) - 209.99.40.224
    Server software: Apache
    Technology: Html
    Number of meta tags: 2

Check Other Websites